Login to display prices
Login to display prices
TBCB purified MaxPab mouse polyclonal antibody (B02P) View larger

TBCB purified MaxPab mouse polyclonal antibody (B02P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBCB purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about TBCB purified MaxPab mouse polyclonal antibody (B02P)

Reference: H00001155-B02P
Product name: TBCB purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human TBCB protein.
Gene id: 1155
Gene name: TBCB
Gene alias: CG22|CKAP1|CKAPI|MGC14625
Gene description: tubulin folding cofactor B
Genbank accession: NM_001281.2
Immunogen: TBCB (NP_001272.2, 1 a.a. ~ 244 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Protein accession: NP_001272.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Shipping condition: Dry Ice

30 other products in the same category: