Login to display prices
Login to display prices
TBCB MaxPab mouse polyclonal antibody (B02) View larger

TBCB MaxPab mouse polyclonal antibody (B02)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBCB MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about TBCB MaxPab mouse polyclonal antibody (B02)

Reference: H00001155-B02
Product name: TBCB MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human TBCB protein.
Gene id: 1155
Gene name: TBCB
Gene alias: CG22|CKAP1|CKAPI|MGC14625
Gene description: tubulin folding cofactor B
Genbank accession: NM_001281.2
Immunogen: TBCB (NP_001272.2, 1 a.a. ~ 244 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Protein accession: NP_001272.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Shipping condition: Dry Ice

30 other products in the same category: