Login to display prices
Login to display prices
TBCB MaxPab mouse polyclonal antibody (B01) View larger

TBCB MaxPab mouse polyclonal antibody (B01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBCB MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about TBCB MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00001155-B01
Product name: TBCB MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human TBCB protein.
Gene id: 1155
Gene name: TBCB
Gene alias: CG22|CKAP1|CKAPI|MGC14625
Gene description: tubulin folding cofactor B
Genbank accession: BC005969
Immunogen: TBCB (AAH05969, 1 a.a. ~ 244 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEVTGVSAPTVTVFISSSLNTFRSEKRYSRSLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKLGRYNEEERAQQEAEAAQRLAEEKAQASSIPVGSRCEVRAAGQSPRRGTVMYVGLTDFKPGYWIGVRYDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Protein accession: AAH05969
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001155-B01-13-15-1.jpg
Application image note: Western Blot analysis of TBCB expression in transfected 293T cell line (H00001155-T01) by TBCB MaxPab polyclonal antibody.

Lane 1: CKAP1 transfected lysate(26.84 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Related products: - TBCB purified MaxPab mouse polyclonal antibody (B01P)
- TBCB MaxPab mouse polyclonal antibody (B02)
- TBCB purified MaxPab mouse polyclonal antibody (B02P)
- CKM polyclonal antibody (A01)
- CKM purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice