TBCB polyclonal antibody (A01) View larger

TBCB polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBCB polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about TBCB polyclonal antibody (A01)

Brand: Abnova
Reference: H00001155-A01
Product name: TBCB polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant TBCB.
Gene id: 1155
Gene name: TBCB
Gene alias: CG22|CKAP1|CKAPI|MGC14625
Gene description: tubulin folding cofactor B
Genbank accession: NM_001281
Immunogen: TBCB (NP_001272, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKL
Protein accession: NP_001272
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001155-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001155-A01-1-34-1.jpg
Application image note: CKAP1 polyclonal antibody (A01), Lot # 060428JCS1 Western Blot analysis of CKAP1 expression in SJCRH30 ( Cat # L027V1 ).
Applications: WB-Ce,ELISA,WB-Re
Related products: - TBCB MaxPab mouse polyclonal antibody (B01)
- TBCB purified MaxPab mouse polyclonal antibody (B01P)
- TBCB MaxPab mouse polyclonal antibody (B02)
- TBCB purified MaxPab mouse polyclonal antibody (B02P)
- CKM polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy TBCB polyclonal antibody (A01) now

Add to cart