CIRBP (Human) Recombinant Protein (P02) View larger

CIRBP (Human) Recombinant Protein (P02)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIRBP (Human) Recombinant Protein (P02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CIRBP (Human) Recombinant Protein (P02)

Brand: Abnova
Reference: H00001153-P02
Product name: CIRBP (Human) Recombinant Protein (P02)
Product description: Human CIRBP full-length ORF ( AAH00403, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 1153
Gene name: CIRBP
Gene alias: CIRP
Gene description: cold inducible RNA binding protein
Genbank accession: BC000403
Immunogen sequence/protein sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Protein accession: AAH00403
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00001153-P02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - CIRBP (Human) Recombinant Protein (Q01)
- CISH (Human) Recombinant Protein (P01)
- CISH (Human) Recombinant Protein (P02)
- CISH (Human) Recombinant Protein (Q01)
- TBCB (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice
Publications: Serum autoantibody signature of ductal carcinoma in situ progression to invasive breast cancer.Mange A, Lacombe J, Bascoul Mollevi C, Jarlier M, Lamy PJ, Rouanet P, Maudelonde T, Solassol J.
Clin Cancer Res. 2012 Feb 9. [Epub ahead of print]

Buy CIRBP (Human) Recombinant Protein (P02) now

Add to cart