No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Wheat Germ (in vitro) |
Applications | AP,Array,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001153-P02 |
Product name: | CIRBP (Human) Recombinant Protein (P02) |
Product description: | Human CIRBP full-length ORF ( AAH00403, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 1153 |
Gene name: | CIRBP |
Gene alias: | CIRP |
Gene description: | cold inducible RNA binding protein |
Genbank accession: | BC000403 |
Immunogen sequence/protein sequence: | MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE |
Protein accession: | AAH00403 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | ![]() |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Serum autoantibody signature of ductal carcinoma in situ progression to invasive breast cancer.Mange A, Lacombe J, Bascoul Mollevi C, Jarlier M, Lamy PJ, Rouanet P, Maudelonde T, Solassol J. Clin Cancer Res. 2012 Feb 9. [Epub ahead of print] |