Login to display prices
Login to display prices
CIRBP monoclonal antibody (M03), clone 1C9 View larger

CIRBP monoclonal antibody (M03), clone 1C9

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIRBP monoclonal antibody (M03), clone 1C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CIRBP monoclonal antibody (M03), clone 1C9

Reference: H00001153-M03
Product name: CIRBP monoclonal antibody (M03), clone 1C9
Product description: Mouse monoclonal antibody raised against a partial recombinant CIRBP.
Clone: 1C9
Isotype: IgG2a Kappa
Gene id: 1153
Gene name: CIRBP
Gene alias: CIRP
Gene description: cold inducible RNA binding protein
Genbank accession: NM_001280
Immunogen: CIRBP (NP_001271.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRS
Protein accession: NP_001271.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: