CIRBP monoclonal antibody (M03), clone 1C9 View larger

CIRBP monoclonal antibody (M03), clone 1C9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIRBP monoclonal antibody (M03), clone 1C9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about CIRBP monoclonal antibody (M03), clone 1C9

Brand: Abnova
Reference: H00001153-M03
Product name: CIRBP monoclonal antibody (M03), clone 1C9
Product description: Mouse monoclonal antibody raised against a partial recombinant CIRBP.
Clone: 1C9
Isotype: IgG2a Kappa
Gene id: 1153
Gene name: CIRBP
Gene alias: CIRP
Gene description: cold inducible RNA binding protein
Genbank accession: NM_001280
Immunogen: CIRBP (NP_001271.1, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRS
Protein accession: NP_001271.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001153-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001153-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CIRBP is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Buy CIRBP monoclonal antibody (M03), clone 1C9 now

Add to cart