Login to display prices
Login to display prices
CIRBP purified MaxPab rabbit polyclonal antibody (D01P) View larger

CIRBP purified MaxPab rabbit polyclonal antibody (D01P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIRBP purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsIF,WB-Tr

More info about CIRBP purified MaxPab rabbit polyclonal antibody (D01P)

Reference: H00001153-D01P
Product name: CIRBP purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human CIRBP protein.
Gene id: 1153
Gene name: CIRBP
Gene alias: CIRP
Gene description: cold inducible RNA binding protein
Genbank accession: NM_001280.1
Immunogen: CIRBP (NP_001271.1, 1 a.a. ~ 172 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Protein accession: NP_001271.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Shipping condition: Dry Ice

30 other products in the same category: