CKB (Human) Recombinant Protein (P01) View larger

CKB (Human) Recombinant Protein (P01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKB (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CKB (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00001152-P01
Product name: CKB (Human) Recombinant Protein (P01)
Product description: Human CKB full-length ORF ( AAH01190, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 1152
Gene name: CKB
Gene alias: B-CK|CKBB
Gene description: creatine kinase, brain
Genbank accession: BC001190
Immunogen sequence/protein sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Protein accession: AAH01190
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00001152-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - CKB (Human) Recombinant Protein (Q01)
- CIRBP (Human) Recombinant Protein (P01)
- CIRBP (Human) Recombinant Protein (P02)
- CIRBP (Human) Recombinant Protein (Q01)
- CISH (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice

Buy CKB (Human) Recombinant Protein (P01) now

Add to cart