CKB monoclonal antibody (M01), clone 3D5-3D11 View larger

CKB monoclonal antibody (M01), clone 3D5-3D11

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKB monoclonal antibody (M01), clone 3D5-3D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CKB monoclonal antibody (M01), clone 3D5-3D11

Brand: Abnova
Reference: H00001152-M01
Product name: CKB monoclonal antibody (M01), clone 3D5-3D11
Product description: Mouse monoclonal antibody raised against a full length recombinant CKB.
Clone: 3D5-3D11
Isotype: IgG1 Kappa
Gene id: 1152
Gene name: CKB
Gene alias: B-CK|CKBB
Gene description: creatine kinase, brain
Genbank accession: BC001190
Immunogen: CKB (AAH01190, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Protein accession: AAH01190
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001152-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (67.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001152-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to CKB on HeLa cell. [antibody concentration 30 ug/ml]
Applications: IF,S-ELISA,ELISA,WB-Re
Related products: - CIRBP monoclonal antibody (M03), clone 1C9
- CKM monoclonal antibody (M01), clone 3E1-F3
- CKM monoclonal antibody (M01A), clone 3E1-F3
- CKM monoclonal antibody (M02), clone 1E3
- CKM monoclonal antibody (M06), clone 2F3-B11
Shipping condition: Dry Ice

Buy CKB monoclonal antibody (M01), clone 3D5-3D11 now

Add to cart