CKB polyclonal antibody (A03) View larger

CKB polyclonal antibody (A03)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKB polyclonal antibody (A03)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CKB polyclonal antibody (A03)

Brand: Abnova
Reference: H00001152-A03
Product name: CKB polyclonal antibody (A03)
Product description: Mouse polyclonal antibody raised against a partial recombinant CKB.
Gene id: 1152
Gene name: CKB
Gene alias: B-CK|CKBB
Gene description: creatine kinase, brain
Genbank accession: NM_001823
Immunogen: CKB (NP_001814, 281 a.a. ~ 381 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Protein accession: NP_001814
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001152-A03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.22 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - CIRBP purified MaxPab rabbit polyclonal antibody (D01P)
- CISH purified MaxPab mouse polyclonal antibody (B01P)
- CISH purified MaxPab rabbit polyclonal antibody (D01P)
- TBCB polyclonal antibody (A01)
- TBCB MaxPab mouse polyclonal antibody (B01)
Shipping condition: Dry Ice

Buy CKB polyclonal antibody (A03) now

Add to cart