Login to display prices
Login to display prices
CKB polyclonal antibody (A03) View larger

CKB polyclonal antibody (A03)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKB polyclonal antibody (A03)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CKB polyclonal antibody (A03)

Reference: H00001152-A03
Product name: CKB polyclonal antibody (A03)
Product description: Mouse polyclonal antibody raised against a partial recombinant CKB.
Gene id: 1152
Gene name: CKB
Gene alias: B-CK|CKBB
Gene description: creatine kinase, brain
Genbank accession: NM_001823
Immunogen: CKB (NP_001814, 281 a.a. ~ 381 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Protein accession: NP_001814
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: