CKB polyclonal antibody (A01) View larger

CKB polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CKB polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CKB polyclonal antibody (A01)

Brand: Abnova
Reference: H00001152-A01
Product name: CKB polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant CKB.
Gene id: 1152
Gene name: CKB
Gene alias: B-CK|CKBB
Gene description: creatine kinase, brain
Genbank accession: BC001190
Immunogen: CKB (AAH01190, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK
Protein accession: AAH01190
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001152-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (68.02 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - CKB polyclonal antibody (A03)
- CIRBP purified MaxPab rabbit polyclonal antibody (D01P)
- CISH purified MaxPab mouse polyclonal antibody (B01P)
- CISH purified MaxPab rabbit polyclonal antibody (D01P)
- TBCB polyclonal antibody (A01)
Shipping condition: Dry Ice
Publications: Involvement of creatine kinase B in hepatitis C virus genome replication through interaction with the viral NS4A protein.Hara H, Aizaki H, Matsuda M, Shinkai-Ouchi F, Inoue Y, Murakami K, Shoji I, Kawakami H, Matsuura Y, Lai MM, Miyamura T, Wakita T, Suzuki T.
J Virol. 2009 May;83(10):5137-47. Epub 2009 Mar 4.

Buy CKB polyclonal antibody (A01) now

Add to cart