Login to display prices
Login to display prices
CIDEA monoclonal antibody (M01), clone 4B9 View larger

CIDEA monoclonal antibody (M01), clone 4B9

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIDEA monoclonal antibody (M01), clone 4B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about CIDEA monoclonal antibody (M01), clone 4B9

Reference: H00001149-M01
Product name: CIDEA monoclonal antibody (M01), clone 4B9
Product description: Mouse monoclonal antibody raised against a full length recombinant CIDEA.
Clone: 4B9
Isotype: IgG2a Kappa
Gene id: 1149
Gene name: CIDEA
Gene alias: CIDE-A
Gene description: cell death-inducing DFFA-like effector a
Genbank accession: BC031896
Immunogen: CIDEA (AAH31896, 1 a.a. ~ 253 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Protein accession: AAH31896
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: