CIDEA monoclonal antibody (M01), clone 4B9 View larger

CIDEA monoclonal antibody (M01), clone 4B9

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIDEA monoclonal antibody (M01), clone 4B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about CIDEA monoclonal antibody (M01), clone 4B9

Brand: Abnova
Reference: H00001149-M01
Product name: CIDEA monoclonal antibody (M01), clone 4B9
Product description: Mouse monoclonal antibody raised against a full length recombinant CIDEA.
Clone: 4B9
Isotype: IgG2a Kappa
Gene id: 1149
Gene name: CIDEA
Gene alias: CIDE-A
Gene description: cell death-inducing DFFA-like effector a
Genbank accession: BC031896
Immunogen: CIDEA (AAH31896, 1 a.a. ~ 253 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Protein accession: AAH31896
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001149-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (53.57 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001149-M01-31-15-1.jpg
Application image note: Immunoprecipitation of CIDEA transfected lysate using anti-CIDEA monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CIDEA MaxPab rabbit polyclonal antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,IP
Related products: - CKB monoclonal antibody (M01), clone 3D5-3D11
- CIRBP monoclonal antibody (M03), clone 1C9
- CKM monoclonal antibody (M01), clone 3E1-F3
- CKM monoclonal antibody (M01A), clone 3E1-F3
- CKM monoclonal antibody (M02), clone 1E3
Shipping condition: Dry Ice
Publications: Immunotherapeutic Potential of Anti-Human Endogenous Retrovirus-K Envelope Protein Antibodies in Targeting Breast Tumors.Wang-Johanning F, Rycaj K, Plummer JB, Li M, Yin B, Frerich K, Garza JG, Shen J, Lin K, Yan P, Glynn SA, Dorsey TH, Hunt KK, Ambs S, Johanning GL.
J Natl Cancer Inst. 2012 Feb 8;104(3):189-210. Epub 2012 Jan 12.

Buy CIDEA monoclonal antibody (M01), clone 4B9 now

Add to cart