Login to display prices
Login to display prices
CIDEA MaxPab rabbit polyclonal antibody (D01) View larger

CIDEA MaxPab rabbit polyclonal antibody (D01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIDEA MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about CIDEA MaxPab rabbit polyclonal antibody (D01)

Reference: H00001149-D01
Product name: CIDEA MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human CIDEA protein.
Gene id: 1149
Gene name: CIDEA
Gene alias: CIDE-A
Gene description: cell death-inducing DFFA-like effector a
Genbank accession: NM_198289
Immunogen: CIDEA (NP_938031.1, 1 a.a. ~ 253 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Protein accession: NP_938031.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Shipping condition: Dry Ice

30 other products in the same category: