CIDEA purified MaxPab mouse polyclonal antibody (B01P) View larger

CIDEA purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIDEA purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CIDEA purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001149-B01P
Product name: CIDEA purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CIDEA protein.
Gene id: 1149
Gene name: CIDEA
Gene alias: CIDE-A
Gene description: cell death-inducing DFFA-like effector a
Genbank accession: NM_198289
Immunogen: CIDEA (NP_938031.1, 1 a.a. ~ 253 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Protein accession: NP_938031.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001149-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CIDEA expression in transfected 293T cell line (H00001149-T01) by CIDEA MaxPab polyclonal antibody.

Lane 1: CIDEA transfected lysate(27.83 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Related products: - CIDEA MaxPab rabbit polyclonal antibody (D01)
- CIDEA purified MaxPab rabbit polyclonal antibody (D01P)
- CKB polyclonal antibody (A01)
- CKB polyclonal antibody (A03)
- CIRBP purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice

Buy CIDEA purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart