CIDEA MaxPab mouse polyclonal antibody (B01) View larger

CIDEA MaxPab mouse polyclonal antibody (B01)

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CIDEA MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CIDEA MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00001149-B01
Product name: CIDEA MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human CIDEA protein.
Gene id: 1149
Gene name: CIDEA
Gene alias: CIDE-A
Gene description: cell death-inducing DFFA-like effector a
Genbank accession: NM_198289
Immunogen: CIDEA (NP_938031.1, 1 a.a. ~ 253 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Protein accession: NP_938031.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001149-B01-13-15-1.jpg
Application image note: Western Blot analysis of CIDEA expression in transfected 293T cell line (H00001149-T01) by CIDEA MaxPab polyclonal antibody.

Lane 1: CIDEA transfected lysate(27.83 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Related products: - CIDEA purified MaxPab mouse polyclonal antibody (B01P)
- CIDEA MaxPab rabbit polyclonal antibody (D01)
- CIDEA purified MaxPab rabbit polyclonal antibody (D01P)
- CKB polyclonal antibody (A01)
- CKB polyclonal antibody (A03)
Shipping condition: Dry Ice

Buy CIDEA MaxPab mouse polyclonal antibody (B01) now

Add to cart