No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,ELISA,WB-Re,PLA-Ce |
| Brand: | Abnova |
| Reference: | H00001147-M04 |
| Product name: | CHUK monoclonal antibody (M04), clone 2G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CHUK. |
| Clone: | 2G4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1147 |
| Gene name: | CHUK |
| Gene alias: | IKBKA|IKK-alpha|IKK1|IKKA|NFKBIKA|TCF16 |
| Gene description: | conserved helix-loop-helix ubiquitous kinase |
| Genbank accession: | NM_001278 |
| Immunogen: | CHUK (NP_001269, 646 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE |
| Protein accession: | NP_001269 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunoperoxidase of monoclonal antibody to CHUK on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re,PLA-Ce |
| Shipping condition: | Dry Ice |