CHUK monoclonal antibody (M02), clone 1F8 View larger

CHUK monoclonal antibody (M02), clone 1F8

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHUK monoclonal antibody (M02), clone 1F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,PLA-Ce

More info about CHUK monoclonal antibody (M02), clone 1F8

Brand: Abnova
Reference: H00001147-M02
Product name: CHUK monoclonal antibody (M02), clone 1F8
Product description: Mouse monoclonal antibody raised against a partial recombinant CHUK.
Clone: 1F8
Isotype: IgG1 Kappa
Gene id: 1147
Gene name: CHUK
Gene alias: IKBKA|IKK-alpha|IKK1|IKKA|NFKBIKA|TCF16
Gene description: conserved helix-loop-helix ubiquitous kinase
Genbank accession: NM_001278
Immunogen: CHUK (NP_001269, 646 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE
Protein accession: NP_001269
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001147-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001147-M02-57-1-1.jpg
Application image note: Proximity Ligation Analysis of protein-protein interactions between PRKCB and CHUK. HeLa cells were stained with anti-PRKCB rabbit purified polyclonal 1:1200 and anti-CHUK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Applications: IF,S-ELISA,ELISA,WB-Re,PLA-Ce
Related products: - CHUK monoclonal antibody (M03), clone 4B8
- CHUK monoclonal antibody (M04), clone 2G4
- CIDEA monoclonal antibody (M01), clone 4B9
- CKB monoclonal antibody (M01), clone 3D5-3D11
- CIRBP monoclonal antibody (M03), clone 1C9
Shipping condition: Dry Ice

Buy CHUK monoclonal antibody (M02), clone 1F8 now

Add to cart