CHRNE monoclonal antibody (M02), clone 1H5 View larger

CHRNE monoclonal antibody (M02), clone 1H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRNE monoclonal antibody (M02), clone 1H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CHRNE monoclonal antibody (M02), clone 1H5

Brand: Abnova
Reference: H00001145-M02
Product name: CHRNE monoclonal antibody (M02), clone 1H5
Product description: Mouse monoclonal antibody raised against a partial recombinant CHRNE.
Clone: 1H5
Isotype: IgG3 Kappa
Gene id: 1145
Gene name: CHRNE
Gene alias: ACHRE|CMS1D|CMS1E|CMS2A|FCCMS|SCCMS
Gene description: cholinergic receptor, nicotinic, epsilon
Genbank accession: NM_000080
Immunogen: CHRNE (NP_000071, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLV
Protein accession: NP_000071
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001145-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001145-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CHRNE is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHRNE monoclonal antibody (M02), clone 1H5 now

Add to cart