CHRNE polyclonal antibody (A01) View larger

CHRNE polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRNE polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CHRNE polyclonal antibody (A01)

Brand: Abnova
Reference: H00001145-A01
Product name: CHRNE polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CHRNE.
Gene id: 1145
Gene name: CHRNE
Gene alias: ACHRE|CMS1D|CMS1E|CMS2A|FCCMS|SCCMS
Gene description: cholinergic receptor, nicotinic, epsilon
Genbank accession: NM_000080
Immunogen: CHRNE (NP_000071, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLV
Protein accession: NP_000071
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001145-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - CIDEA MaxPab mouse polyclonal antibody (B01)
- CIDEA purified MaxPab mouse polyclonal antibody (B01P)
- CIDEA MaxPab rabbit polyclonal antibody (D01)
- CIDEA purified MaxPab rabbit polyclonal antibody (D01P)
- CKB polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy CHRNE polyclonal antibody (A01) now

Add to cart