Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001144-M01 |
Product name: | CHRND monoclonal antibody (M01), clone 2B2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHRND. |
Clone: | 2B2 |
Isotype: | IgG2a Kappa |
Gene id: | 1144 |
Gene name: | CHRND |
Gene alias: | ACHRD|CMS2A|FCCMS|SCCMS |
Gene description: | cholinergic receptor, nicotinic, delta |
Genbank accession: | NM_000751 |
Immunogen: | CHRND (NP_000742, 24 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCN |
Protein accession: | NP_000742 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CHRND expression in transfected 293T cell line by CHRND monoclonal antibody (M01), clone 2B2. Lane 1: CHRND transfected lysate (Predicted MW: 58.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |