CHRND monoclonal antibody (M01), clone 2B2 View larger

CHRND monoclonal antibody (M01), clone 2B2

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRND monoclonal antibody (M01), clone 2B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about CHRND monoclonal antibody (M01), clone 2B2

Brand: Abnova
Reference: H00001144-M01
Product name: CHRND monoclonal antibody (M01), clone 2B2
Product description: Mouse monoclonal antibody raised against a partial recombinant CHRND.
Clone: 2B2
Isotype: IgG2a Kappa
Gene id: 1144
Gene name: CHRND
Gene alias: ACHRD|CMS2A|FCCMS|SCCMS
Gene description: cholinergic receptor, nicotinic, delta
Genbank accession: NM_000751
Immunogen: CHRND (NP_000742, 24 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCN
Protein accession: NP_000742
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001144-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001144-M01-13-15-1.jpg
Application image note: Western Blot analysis of CHRND expression in transfected 293T cell line by CHRND monoclonal antibody (M01), clone 2B2.

Lane 1: CHRND transfected lysate (Predicted MW: 58.9 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Related products: - CHRNE monoclonal antibody (M01), clone 6A2
- CHRNE monoclonal antibody (M02), clone 1H5
- CHUK monoclonal antibody (M01), clone 4D11
- CHUK monoclonal antibody (M02), clone 1F8
- CHUK monoclonal antibody (M03), clone 4B8
Shipping condition: Dry Ice

Buy CHRND monoclonal antibody (M01), clone 2B2 now

Add to cart