Login to display prices
Login to display prices
CHRND monoclonal antibody (M01), clone 2B2 View larger

CHRND monoclonal antibody (M01), clone 2B2

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRND monoclonal antibody (M01), clone 2B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about CHRND monoclonal antibody (M01), clone 2B2

Reference: H00001144-M01
Product name: CHRND monoclonal antibody (M01), clone 2B2
Product description: Mouse monoclonal antibody raised against a partial recombinant CHRND.
Clone: 2B2
Isotype: IgG2a Kappa
Gene id: 1144
Gene name: CHRND
Gene alias: ACHRD|CMS2A|FCCMS|SCCMS
Gene description: cholinergic receptor, nicotinic, delta
Genbank accession: NM_000751
Immunogen: CHRND (NP_000742, 24 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCN
Protein accession: NP_000742
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: