CHRND polyclonal antibody (A01) View larger

CHRND polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRND polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CHRND polyclonal antibody (A01)

Brand: Abnova
Reference: H00001144-A01
Product name: CHRND polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CHRND.
Gene id: 1144
Gene name: CHRND
Gene alias: ACHRD|CMS2A|FCCMS|SCCMS
Gene description: cholinergic receptor, nicotinic, delta
Genbank accession: NM_000751
Immunogen: CHRND (NP_000742, 24 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEHGWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCN
Protein accession: NP_000742
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001144-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.88 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - CHRND purified MaxPab rabbit polyclonal antibody (D01P)
- CHRNE polyclonal antibody (A01)
- CIDEA MaxPab mouse polyclonal antibody (B01)
- CIDEA purified MaxPab mouse polyclonal antibody (B01P)
- CIDEA MaxPab rabbit polyclonal antibody (D01)
Shipping condition: Dry Ice

Buy CHRND polyclonal antibody (A01) now

Add to cart