CHRNB4 polyclonal antibody (A01) View larger

CHRNB4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRNB4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CHRNB4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00001143-A01
Product name: CHRNB4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CHRNB4.
Gene id: 1143
Gene name: CHRNB4
Gene alias: -
Gene description: cholinergic receptor, nicotinic, beta 4
Genbank accession: NM_000750
Immunogen: CHRNB4 (NP_000741, 68 a.a. ~ 177 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYD
Protein accession: NP_000741
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001143-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - CHRND polyclonal antibody (A01)
- CHRND purified MaxPab rabbit polyclonal antibody (D01P)
- CHRNE polyclonal antibody (A01)
- CIDEA MaxPab mouse polyclonal antibody (B01)
- CIDEA purified MaxPab mouse polyclonal antibody (B01P)
Shipping condition: Dry Ice
Publications: The Ubiquitin-Proteasome System Regulates the Stability of Neuronal Nicotinic Acetylcholine Receptors.Rezvani K, Teng Y, De Biasi M.
J Mol Neurosci. 2009 Aug 20. [Epub ahead of print]

Buy CHRNB4 polyclonal antibody (A01) now

Add to cart