Login to display prices
Login to display prices
CHRNB4 polyclonal antibody (A01) View larger

CHRNB4 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRNB4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about CHRNB4 polyclonal antibody (A01)

Reference: H00001143-A01
Product name: CHRNB4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant CHRNB4.
Gene id: 1143
Gene name: CHRNB4
Gene alias: -
Gene description: cholinergic receptor, nicotinic, beta 4
Genbank accession: NM_000750
Immunogen: CHRNB4 (NP_000741, 68 a.a. ~ 177 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: VNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYD
Protein accession: NP_000741
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: