Login to display prices
Login to display prices
CHRNB3 monoclonal antibody (M01), clone 3G6 View larger

CHRNB3 monoclonal antibody (M01), clone 3G6

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRNB3 monoclonal antibody (M01), clone 3G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CHRNB3 monoclonal antibody (M01), clone 3G6

Reference: H00001142-M01
Product name: CHRNB3 monoclonal antibody (M01), clone 3G6
Product description: Mouse monoclonal antibody raised against a partial recombinant CHRNB3.
Clone: 3G6
Isotype: IgG2b Kappa
Gene id: 1142
Gene name: CHRNB3
Gene alias: -
Gene description: cholinergic receptor, nicotinic, beta 3
Genbank accession: NM_000749
Immunogen: CHRNB3 (NP_000740, 128 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFI
Protein accession: NP_000740
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: