CHRNB3 monoclonal antibody (M01), clone 3G6 View larger

CHRNB3 monoclonal antibody (M01), clone 3G6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRNB3 monoclonal antibody (M01), clone 3G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CHRNB3 monoclonal antibody (M01), clone 3G6

Brand: Abnova
Reference: H00001142-M01
Product name: CHRNB3 monoclonal antibody (M01), clone 3G6
Product description: Mouse monoclonal antibody raised against a partial recombinant CHRNB3.
Clone: 3G6
Isotype: IgG2b Kappa
Gene id: 1142
Gene name: CHRNB3
Gene alias: -
Gene description: cholinergic receptor, nicotinic, beta 3
Genbank accession: NM_000749
Immunogen: CHRNB3 (NP_000740, 128 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFI
Protein accession: NP_000740
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001142-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged CHRNB3 is approximately 10ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CHRNB3 monoclonal antibody (M01), clone 3G6 now

Add to cart