Brand: | Abnova |
Reference: | H00001142-M01 |
Product name: | CHRNB3 monoclonal antibody (M01), clone 3G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHRNB3. |
Clone: | 3G6 |
Isotype: | IgG2b Kappa |
Gene id: | 1142 |
Gene name: | CHRNB3 |
Gene alias: | - |
Gene description: | cholinergic receptor, nicotinic, beta 3 |
Genbank accession: | NM_000749 |
Immunogen: | CHRNB3 (NP_000740, 128 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFI |
Protein accession: | NP_000740 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged CHRNB3 is approximately 10ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |