Brand: | Abnova |
Reference: | H00001141-M01 |
Product name: | CHRNB2 monoclonal antibody (M01), clone 1C7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHRNB2. |
Clone: | 1C7 |
Isotype: | IgG2a Kappa |
Gene id: | 1141 |
Gene name: | CHRNB2 |
Gene alias: | EFNL3|nAChRB2 |
Gene description: | cholinergic receptor, nicotinic, beta 2 (neuronal) |
Genbank accession: | NM_000748 |
Immunogen: | CHRNB2 (NP_000739.1, 26 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS |
Protein accession: | NP_000739.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | CHRNB2 monoclonal antibody (M01), clone 1C7. Western Blot analysis of CHRNB2 expression in rat testis. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |