CHRNB2 monoclonal antibody (M01), clone 1C7 View larger

CHRNB2 monoclonal antibody (M01), clone 1C7

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRNB2 monoclonal antibody (M01), clone 1C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about CHRNB2 monoclonal antibody (M01), clone 1C7

Brand: Abnova
Reference: H00001141-M01
Product name: CHRNB2 monoclonal antibody (M01), clone 1C7
Product description: Mouse monoclonal antibody raised against a partial recombinant CHRNB2.
Clone: 1C7
Isotype: IgG2a Kappa
Gene id: 1141
Gene name: CHRNB2
Gene alias: EFNL3|nAChRB2
Gene description: cholinergic receptor, nicotinic, beta 2 (neuronal)
Genbank accession: NM_000748
Immunogen: CHRNB2 (NP_000739.1, 26 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS
Protein accession: NP_000739.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00001141-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00001141-M01-2-92-1.jpg
Application image note: CHRNB2 monoclonal antibody (M01), clone 1C7. Western Blot analysis of CHRNB2 expression in rat testis.
Applications: WB-Ti,ELISA,WB-Re
Related products: - CHRNB3 monoclonal antibody (M01), clone 3G6
- CHRND monoclonal antibody (M01), clone 2B2
- CHRNE monoclonal antibody (M01), clone 6A2
- CHRNE monoclonal antibody (M02), clone 1H5
- CHUK monoclonal antibody (M01), clone 4D11
Shipping condition: Dry Ice

Buy CHRNB2 monoclonal antibody (M01), clone 1C7 now

Add to cart