Login to display prices
Login to display prices
CHRNB2 monoclonal antibody (M01), clone 1C7 View larger

CHRNB2 monoclonal antibody (M01), clone 1C7

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CHRNB2 monoclonal antibody (M01), clone 1C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about CHRNB2 monoclonal antibody (M01), clone 1C7

Reference: H00001141-M01
Product name: CHRNB2 monoclonal antibody (M01), clone 1C7
Product description: Mouse monoclonal antibody raised against a partial recombinant CHRNB2.
Clone: 1C7
Isotype: IgG2a Kappa
Gene id: 1141
Gene name: CHRNB2
Gene alias: EFNL3|nAChRB2
Gene description: cholinergic receptor, nicotinic, beta 2 (neuronal)
Genbank accession: NM_000748
Immunogen: CHRNB2 (NP_000739.1, 26 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS
Protein accession: NP_000739.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: