| Brand: | Abnova |
| Reference: | H00001137-M01 |
| Product name: | CHRNA4 monoclonal antibody (M01), clone 4E3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CHRNA4. |
| Clone: | 4E3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 1137 |
| Gene name: | CHRNA4 |
| Gene alias: | BFNC|EBN|EBN1|FLJ95812|NACHR|NACHRA4|NACRA4 |
| Gene description: | cholinergic receptor, nicotinic, alpha 4 |
| Genbank accession: | NM_000744 |
| Immunogen: | CHRNA4 (NP_000735, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNN |
| Protein accession: | NP_000735 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |