Brand: | Abnova |
Reference: | H00001134-M04 |
Product name: | CHRNA1 monoclonal antibody (M04), clone 2G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHRNA1. |
Clone: | 2G5 |
Isotype: | IgG2a Kappa |
Gene id: | 1134 |
Gene name: | CHRNA1 |
Gene alias: | ACHRA|ACHRD|CHRNA|CMS2A|FCCMS|SCCMS |
Gene description: | cholinergic receptor, nicotinic, alpha 1 (muscle) |
Genbank accession: | NM_000079 |
Immunogen: | CHRNA1 (NP_000070.1, 146 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP |
Protein accession: | NP_000070.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CHRNA1 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |