| Brand: | Abnova |
| Reference: | H00001123-M03 |
| Product name: | CHN1 monoclonal antibody (M03), clone 3A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CHN1. |
| Clone: | 3A3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1123 |
| Gene name: | CHN1 |
| Gene alias: | ARHGAP2|CHN|DURS2|RHOGAP2 |
| Gene description: | chimerin (chimaerin) 1 |
| Genbank accession: | BC011393 |
| Immunogen: | CHN1 (AAH11393, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIP |
| Protein accession: | AAH11393 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CHN1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Tsc2-Rheb signaling regulates EphA-mediated axon guidance.Nie D, Di Nardo A, Han JM, Baharanyi H, Kramvis I, Huynh T, Dabora S, Codeluppi S, Pandolfi PP, Pasquale EB, Sahin M. Nat Neurosci. 2010 Jan 10. [Epub ahead of print] |