Brand: | Abnova |
Reference: | H00001123-M01 |
Product name: | CHN1 monoclonal antibody (M01), clone 3F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHN1. |
Clone: | 3F8 |
Isotype: | IgG1 Kappa |
Gene id: | 1123 |
Gene name: | CHN1 |
Gene alias: | ARHGAP2|CHN|DURS2|RHOGAP2 |
Gene description: | chimerin (chimaerin) 1 |
Genbank accession: | BC011393 |
Immunogen: | CHN1 (AAH11393, 91 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QTRNFRLYYDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVSEKRLTSLVRRATLKENEQIP |
Protein accession: | AAH11393 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged CHN1 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Tsc2-Rheb signaling regulates EphA-mediated axon guidance.Nie D, Di Nardo A, Han JM, Baharanyi H, Kramvis I, Huynh T, Dabora S, Codeluppi S, Pandolfi PP, Pasquale EB, Sahin M. Nat Neurosci. 2010 Jan 10. [Epub ahead of print] |