Brand: | Abnova |
Reference: | H00001122-M03 |
Product name: | CHML monoclonal antibody (M03), clone 5G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHML. |
Clone: | 5G4 |
Isotype: | IgG2a Kappa |
Gene id: | 1122 |
Gene name: | CHML |
Gene alias: | FLJ10071|FLJ13361|REP2 |
Gene description: | choroideremia-like (Rab escort protein 2) |
Genbank accession: | NM_001821 |
Immunogen: | CHML (NP_001812, 68 a.a. ~ 177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IGEESTVVWQDLIHETEEAITLRKKDETIQHTEAFCYASQDMEDNVEEIGALQKNPSLGVSNTFTEVLDSALPEESQLSYFNSDEMPAKHTQKSDTEISLEVTDVEESVE |
Protein accession: | NP_001812 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CHML is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |