Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CHKA polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about CHKA polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001119-A01 |
| Product name: | CHKA polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CHKA. |
| Gene id: | 1119 |
| Gene name: | CHKA |
| Gene alias: | CHK|CKI |
| Gene description: | choline kinase alpha |
| Genbank accession: | NM_212469 |
| Immunogen: | CHKA (NP_997634, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | ILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNR |
| Protein accession: | NP_997634 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CHKA polyclonal antibody (A01), Lot # GPC1060208QCS1 Western Blot analysis of CHKA expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Influence of multidrug resistance on (18)F-FCH cellular uptake in a glioblastoma model.Vanpouille C, Le Jeune N, Kryza D, Clotagatide A, Janier M, Dubois F, Perek N. Eur J Nucl Med Mol Imaging. 2009 Aug;36(8):1256-64. Epub 2009 Mar 20. |