Brand: | Abnova |
Reference: | H00001113-M01 |
Product name: | CHGA monoclonal antibody (M01), clone 4D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHGA. |
Clone: | 4D6 |
Isotype: | IgG2b Kappa |
Gene id: | 1113 |
Gene name: | CHGA |
Gene alias: | CGA |
Gene description: | chromogranin A (parathyroid secretory protein 1) |
Genbank accession: | BC006459 |
Immunogen: | CHGA (AAH06459, 338 a.a. ~ 432 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQ |
Protein accession: | AAH06459 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CHGA is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |