Brand: | Abnova |
Reference: | H00001108-M01A |
Product name: | CHD4 monoclonal antibody (M01A), clone 4H4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CHD4. |
Clone: | 4H4 |
Isotype: | IgG2a Kappa |
Gene id: | 1108 |
Gene name: | CHD4 |
Gene alias: | DKFZp686E06161|Mi-2b|Mi2-BETA |
Gene description: | chromodomain helicase DNA binding protein 4 |
Genbank accession: | NM_001273 |
Immunogen: | CHD4 (NP_001264, 1632 a.a. ~ 1730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWH |
Protein accession: | NP_001264 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CHD4 monoclonal antibody (M01A), clone 4H4 Western Blot analysis of CHD4 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |