Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CHD1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CHD1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00001105-A01 |
| Product name: | CHD1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CHD1. |
| Gene id: | 1105 |
| Gene name: | CHD1 |
| Gene alias: | DKFZp686E2337 |
| Gene description: | chromodomain helicase DNA binding protein 1 |
| Genbank accession: | NM_001270 |
| Immunogen: | CHD1 (NP_001261, 1177 a.a. ~ 1272 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | IKALKDSSSGTERTGGRLGKVKGPTFRISGVQVNAKLVISHEEELIPLHKSIPSDPEERKQYTIPCHTKAAHFDIDWGKEDDSNLLIGIYEYGYGS |
| Protein accession: | NP_001261 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Chromatin Reassembly Factors Are Involved in Transcriptional Interference Promoting HIV Latency.Gallastegui E, Millan-Zambrano G, Terme JM, Chavez S, Jordan A. J Virol. 2011 Apr;85(7):3187-202. Epub 2011 Jan 26. |