Brand: | Abnova |
Reference: | H00001102-M06 |
Product name: | RCBTB2 monoclonal antibody (M06), clone 4G12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RCBTB2. |
Clone: | 4G12 |
Isotype: | IgG2a Kappa |
Gene id: | 1102 |
Gene name: | RCBTB2 |
Gene alias: | CHC1L |
Gene description: | regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2 |
Genbank accession: | NM_001268 |
Immunogen: | RCBTB2 (NP_001259, 86 a.a. ~ 194 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TIEPRRLDSLNGKKIACLSYGSGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPI |
Protein accession: | NP_001259 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RCBTB2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |