| Brand: | Abnova |
| Reference: | H00001080-Q01 |
| Product name: | CFTR (Human) Recombinant Protein (Q01) |
| Product description: | Human CFTR partial ORF ( NP_000483, 1381 a.a. - 1480 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 1080 |
| Gene name: | CFTR |
| Gene alias: | ABC35|ABCC7|CF|CFTR/MRP|MRP7|TNR-CFTR|dJ760C5.1 |
| Gene description: | cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7) |
| Genbank accession: | NM_000492 |
| Immunogen sequence/protein sequence: | YQIIRRTLKQAFADCTVILCEHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL |
| Protein accession: | NP_000483 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Cystic Fibrosis Transmembrane Conductance Regulator Attaches Tumor Suppressor PTEN to the Membrane and Promotes Anti Pseudomonas aeruginosa Immunity.Riquelme SA, Hopkins BD, Wolfe AL, DiMango E, Kitur K, Parsons R, Prince A. Immunity. 2017 Dec 19;47(6):1169-1181.e7. doi: 10.1016/j.immuni.2017.11.010. Epub 2017 Dec 12. |