Brand: | Abnova |
Reference: | H00001054-D01 |
Product name: | CEBPG MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human CEBPG protein. |
Gene id: | 1054 |
Gene name: | CEBPG |
Gene alias: | GPE1BP|IG/EBP-1 |
Gene description: | CCAAT/enhancer binding protein (C/EBP), gamma |
Genbank accession: | NM_001806.2 |
Immunogen: | CEBPG (NP_001797.1, 1 a.a. ~ 150 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ |
Protein accession: | NP_001797.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of CEBPG transfected lysate using anti-CEBPG MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CEBPG MaxPab mouse polyclonal antibody (B01) (H00001054-B01). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |