No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00001054-A01 |
Product name: | CEBPG polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant CEBPG. |
Gene id: | 1054 |
Gene name: | CEBPG |
Gene alias: | GPE1BP|IG/EBP-1 |
Gene description: | CCAAT/enhancer binding protein (C/EBP), gamma |
Genbank accession: | BC013128 |
Immunogen: | CEBPG (AAH13128, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ |
Protein accession: | AAH13128 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (42.61 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of CEBPG expression in transfected 293T cell line by CEBPG polyclonal antibody (A01). Lane1:CEBPG transfected lysate(16 KDa). Lane2:Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |