| Brand: | Abnova |
| Reference: | H00001053-A01 |
| Product name: | CEBPE polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant CEBPE. |
| Gene id: | 1053 |
| Gene name: | CEBPE |
| Gene alias: | C/EBP-epsilon|CRP1 |
| Gene description: | CCAAT/enhancer binding protein (C/EBP), epsilon |
| Genbank accession: | BC035797 |
| Immunogen: | CEBPE (AAH35797.2, 1 a.a. ~ 281 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS |
| Protein accession: | AAH35797.2 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (57.02 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | CEBPE polyclonal antibody (A01), Lot # 050921JC01. Western Blot analysis of CEBPE expression in Daoy. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |