| Brand: | Abnova |
| Reference: | H00001046-M16 |
| Product name: | CDX4 monoclonal antibody (M16), clone 1E11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant CDX4. |
| Clone: | 1E11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1046 |
| Gene name: | CDX4 |
| Gene alias: | - |
| Gene description: | caudal type homeobox 4 |
| Genbank accession: | NM_005193 |
| Immunogen: | CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE* |
| Protein accession: | NP_005184 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.13 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | CDX4 monoclonal antibody (M16), clone 1E11 Western Blot analysis of CDX4 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |