No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,IF,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00001046-M12 |
Product name: | CDX4 monoclonal antibody (M12), clone 1E9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant CDX4. |
Clone: | 1E9 |
Isotype: | IgG2a Kappa |
Gene id: | 1046 |
Gene name: | CDX4 |
Gene alias: | - |
Gene description: | caudal type homeobox 4 |
Genbank accession: | NM_005193 |
Immunogen: | CDX4 (NP_005184, 202 a.a. ~ 284 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE* |
Protein accession: | NP_005184 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.13 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | CDX4 monoclonal antibody (M12), clone 1E9 Western Blot analysis of CDX4 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |