Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDX1 monoclonal antibody (M01), clone 2D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,ELISA,WB-Re |
More info about CDX1 monoclonal antibody (M01), clone 2D8
| Brand: | Abnova |
| Reference: | H00001044-M01 |
| Product name: | CDX1 monoclonal antibody (M01), clone 2D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDX1. |
| Clone: | 2D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1044 |
| Gene name: | CDX1 |
| Gene alias: | MGC116915 |
| Gene description: | caudal type homeobox 1 |
| Genbank accession: | NM_001804 |
| Immunogen: | CDX1 (NP_001795, 126 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK |
| Protein accession: | NP_001795 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CDX1 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | WB-Ti,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Activation of the BMP4 Pathway and Early Expression of CDX2 Characterize Non-specialized Columnar Metaplasia in a Human Model of Barrett's Esophagus.Castillo D, Puig S, Iglesias M, Seoane A, de Bolos C, Munitiz V, Parrilla P, Comerma L, Poulsom R, Krishnadath KK, Grande L, Pera M. J Gastrointest Surg. 2011 Nov 11. |