Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDSN monoclonal antibody (M01), clone 6F11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about CDSN monoclonal antibody (M01), clone 6F11
| Brand: | Abnova |
| Reference: | H00001041-M01 |
| Product name: | CDSN monoclonal antibody (M01), clone 6F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDSN. |
| Clone: | 6F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1041 |
| Gene name: | CDSN |
| Gene alias: | D6S586E|HTSS|S |
| Gene description: | corneodesmosin |
| Genbank accession: | NM_001264 |
| Immunogen: | CDSN (NP_001255, 306 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP |
| Protein accession: | NP_001255 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.24 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CDSN is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Development and organization of human stratum corneum after birth: electron microscopy isotropy score and immunocytochemical corneocyte labelling as epidermal maturation's markers in infancy.Fluhr JW, Lachmann N, Baudouin C, Msika P, Darlenski R, De Belilovsky C, Bossert J, Colomb E, Burdin B, Haftek M. Br J Dermatol. 2014 Nov;171(5):978-86. |