Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDR2 monoclonal antibody (M01), clone 4F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about CDR2 monoclonal antibody (M01), clone 4F5
| Brand: | Abnova |
| Reference: | H00001039-M01 |
| Product name: | CDR2 monoclonal antibody (M01), clone 4F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDR2. |
| Clone: | 4F5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1039 |
| Gene name: | CDR2 |
| Gene alias: | CDR62|Yo |
| Gene description: | cerebellar degeneration-related protein 2, 62kDa |
| Genbank accession: | NM_001802 |
| Immunogen: | CDR2 (NP_001793, 296 a.a. ~ 404 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LTVPESHRKPLKRSSSETILSSLAGSDIVKGHEETCIRRAKAVKQRGISLLHEVDTQYSALKVKYEELLKKCQEEQDSLSHKAVQTSRAAAKDLTGVNAQSEPVASGWE |
| Protein accession: | NP_001793 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to CDR2 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The Onconeural Antigen cdr2 Is a Novel APC/C Target that Acts in Mitosis to Regulate C-Myc Target Genes in Mammalian Tumor Cells.O'Donovan KJ, Diedler J, Couture GC, Fak JJ, Darnell RB. PLoS One. 2010 Apr 7;5(4):e10045. |