Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDKN2D monoclonal antibody (M08), clone 2E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about CDKN2D monoclonal antibody (M08), clone 2E10
| Brand: | Abnova |
| Reference: | H00001032-M08 |
| Product name: | CDKN2D monoclonal antibody (M08), clone 2E10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CDKN2D. |
| Clone: | 2E10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 1032 |
| Gene name: | CDKN2D |
| Gene alias: | INK4D|p19|p19-INK4D |
| Gene description: | cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) |
| Genbank accession: | BC001822 |
| Immunogen: | CDKN2D (AAH01822, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL |
| Protein accession: | AAH01822 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CDKN2D expression in transfected 293T cell line by CDKN2D monoclonal antibody (M08), clone 2E10. Lane 1: CDKN2D transfected lysate(17.7 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |