CDKN2D purified MaxPab mouse polyclonal antibody (B01P) View larger

CDKN2D purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDKN2D purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about CDKN2D purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00001032-B01P
Product name: CDKN2D purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CDKN2D protein.
Gene id: 1032
Gene name: CDKN2D
Gene alias: INK4D|p19|p19-INK4D
Gene description: cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Genbank accession: BC001822
Immunogen: CDKN2D (AAH01822, 1 a.a. ~ 166 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Protein accession: AAH01822
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00001032-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CDKN2D expression in transfected 293T cell line (H00001032-T01) by CDKN2D MaxPab polyclonal antibody.

Lane1:CDKN2D transfected lysate(18.37 KDa).
Lane 2:Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CDKN2D purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart