| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00001031-B02 |
| Product name: | CDKN2C MaxPab mouse polyclonal antibody (B02) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CDKN2C protein. |
| Gene id: | 1031 |
| Gene name: | CDKN2C |
| Gene alias: | INK4C|p18|p18-INK4C |
| Gene description: | cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4) |
| Genbank accession: | NM_001262 |
| Immunogen: | CDKN2C (NP_001253, 1 a.a. ~ 168 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ |
| Protein accession: | NP_001253 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CDKN2C expression in transfected 293T cell line (H00001031-T02) by CDKN2C MaxPab polyclonal antibody. Lane 1: CDKN2C transfected lysate(18.48 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |