Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDKN2B purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about CDKN2B purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00001030-B02P |
| Product name: | CDKN2B purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human CDKN2B protein. |
| Gene id: | 1030 |
| Gene name: | CDKN2B |
| Gene alias: | CDK4I|INK4B|MTS2|P15|TP15|p15INK4b |
| Gene description: | cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4) |
| Genbank accession: | BC014469 |
| Immunogen: | CDKN2B (AAH14469, 1 a.a. ~ 138 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MREENKGIPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD |
| Protein accession: | AAH14469 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of CDKN2B expression in transfected 293T cell line (H00001030-T01) by CDKN2B MaxPab polyclonal antibody. Lane 1: CDKN2B transfected lysate(15.29 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |