Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CDKN2A monoclonal antibody (M06), clone 3F3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about CDKN2A monoclonal antibody (M06), clone 3F3
| Brand: | Abnova |
| Reference: | H00001029-M06 |
| Product name: | CDKN2A monoclonal antibody (M06), clone 3F3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant CDKN2A. |
| Clone: | 3F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1029 |
| Gene name: | CDKN2A |
| Gene alias: | ARF|CDK4I|CDKN2|CMM2|INK4|INK4a|MLM|MTS1|TP16|p14|p14ARF|p16|p16INK4|p16INK4a|p19 |
| Gene description: | cyclin-dependent kinase inhibitor 2A (melanoma, p16, inhibits CDK4) |
| Genbank accession: | BC015960 |
| Immunogen: | CDKN2A (AAH15960, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMMGSAQVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
| Protein accession: | AAH15960 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CDKN2A is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |