No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00001026-A02 |
Product name: | CDKN1A polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CDKN1A. |
Gene id: | 1026 |
Gene name: | CDKN1A |
Gene alias: | CAP20|CDKN1|CIP1|MDA-6|P21|SDI1|WAF1|p21CIP1 |
Gene description: | cyclin-dependent kinase inhibitor 1A (p21, Cip1) |
Genbank accession: | NM_000389 |
Immunogen: | CDKN1A (AAH00312.1, 65 a.a. ~ 164 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | WERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP |
Protein accession: | AAH00312.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |