| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00001025-M07 |
| Product name: | CDK9 monoclonal antibody (M07), clone 2D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CDK9. |
| Clone: | 2D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 1025 |
| Gene name: | CDK9 |
| Gene alias: | C-2k|CDC2L4|CTK1|PITALRE|TAK |
| Gene description: | cyclin-dependent kinase 9 |
| Genbank accession: | BC001968 |
| Immunogen: | CDK9 (AAH01968, 271 a.a. ~ 372 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF |
| Protein accession: | AAH01968 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of CDK9 expression in transfected 293T cell line by CDK9 monoclonal antibody (M07), clone 2D7. Lane 1: CDK9 transfected lysate(42.778 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |